PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Sevir.2G222100.1.p
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; PACMAD clade; Panicoideae; Panicodae; Paniceae; Cenchrinae; Setaria
Family MYB
Protein Properties Length: 360aa    MW: 38904.4 Da    PI: 7.0131
Description MYB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Sevir.2G222100.1.pgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding42.41.6e-131462148
                        TSSS-HHHHHHHHHHHHHTTTT.-HHHHHHHHTTTS-HHHHHHHHHHHT CS
     Myb_DNA-binding  1 rgrWTteEdellvdavkqlGgg.tWktIartmgkgRtlkqcksrwqkyl 48
                        +g+W +eEd  l+ ++ ++G g +W   ++++g++R++k+c++rw++yl
  Sevir.2G222100.1.p 14 KGPWAPEEDAVLKAYIDEHGAGgNWIQLPHKIGLNRCGKSCRLRWLNYL 62
                        79*********************************************97 PP

2Myb_DNA-binding42.21.9e-1369111246
                         SSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHH CS
     Myb_DNA-binding   2 grWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqk 46 
                         g +T++Ed l+  +    G++ W+tIa+ ++ gRt++++k++w++
  Sevir.2G222100.1.p  69 GGFTEDEDRLICSLYISIGSR-WATIAAQLP-GRTDNDVKNHWNT 111
                         569******************.*********.***********97 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5129413.935962IPR017930Myb domain
SuperFamilySSF466891.68E-2512109IPR009057Homeodomain-like
SMARTSM007176.4E-101364IPR001005SANT/Myb domain
PfamPF002494.6E-121462IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.601.1E-221569IPR009057Homeodomain-like
CDDcd001672.31E-71662No hitNo description
PROSITE profilePS5129421.7163117IPR017930Myb domain
SMARTSM007172.6E-1167115IPR001005SANT/Myb domain
PfamPF002491.7E-1169111IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.601.7E-2170117IPR009057Homeodomain-like
CDDcd001671.16E-871113No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 360 aa     Download sequence    Send to blast
MGRAPCCDKA TVKKGPWAPE EDAVLKAYID EHGAGGNWIQ LPHKIGLNRC GKSCRLRWLN  60
YLRPNIRHGG FTEDEDRLIC SLYISIGSRW ATIAAQLPGR TDNDVKNHWN TKLKRRLLGG  120
GRRPRAETRL QLLMSPTWQQ SSFAASSSAL ERMQASMRLH RRHHQQARLD IPAAFTLYNY  180
GSNLGAPLWP SPSPSPSPSP SPTASEGSEM RPRQLPGATS TAGYSGLWSH MPSSFSYYTG  240
AGVQEHMDGA CTPPLSTSTG GETMTAVGVE SSSSTPTTAS SASATFGDFD DEINMLLRQI  300
QCLPENGQIG DEAGDGVDGC CFRAMNHEAV DGSVVGSWSC CSTPGVDSVF DDYVQGYNQ*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1a5j_A3e-25141177108B-MYB
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankBT0632600.0BT063260.1 Zea mays full-length cDNA clone ZM_BFc0043P16 mRNA, complete cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_004956887.10.0PREDICTED: transcription factor MYB35-like
TrEMBLK3ZUK10.0K3ZUK1_SETIT; Uncharacterized protein
STRINGSi030282m0.0(Setaria italica)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP132652632
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G57620.13e-67myb domain protein 36